Lineage for d1mxlc_ (1mxl C:)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies)
core: 4 helices; array of 2 hairpins, openedSuperfamily a.39.1: EF-hand [47473] (12 families) 
Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
Duplication: made with two pairs of EF-hands
Protein Troponin C [47503] (6 species) Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (17 PDB entries) 
Domain d1mxlc_: 1mxl C: [17255]
Other proteins in same PDB: d1mxli_
N-domain only; complexed with a troponin I fragment
complexed with ca
Details for d1mxlc_
PDB Entry: 1mxl (more details)
PDB Description: structure of cardiac troponin c-troponin i complex
PDB Compounds: (C:) protein (troponin c)SCOPe Domain Sequences for d1mxlc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mxlc_ a.39.1.5 (C:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdeflvmmvrcmkdds
SCOPe Domain Coordinates for d1mxlc_:
Click to download the PDB-style file with coordinates for d1mxlc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mxlc_:
- d1mxlc_ first appeared (with stable ids) in SCOP 1.55
- d1mxlc_ appears in SCOPe 2.05
- d1mxlc_ appears in SCOPe 2.07
- d1mxlc_ appears in the current release, SCOPe 2.08
View in 3D
