Lineage for d1mwoa1 (1mwo A:362-434)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
folded sheet; greek-keySuperfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) 
this domain is C-terminal to the catalytic beta/alpha barrel domainFamily b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
this domain follows the catalytic beta/alpha barrel domain
Protein Bacterial alpha-Amylase [51013] (9 species) 
Species Pyrococcus woesei [TaxId:2262] [89383] (3 PDB entries) 
Domain d1mwoa1: 1mwo A:362-434 [85159]
Other proteins in same PDB: d1mwoa2
complexed with ca, zn
fragment; missing more than one-third of the common structure and/or sequence
Details for d1mwoa1
PDB Entry: 1mwo (more details), 2.2 Å
PDB Description: Crystal Structure Analysis of the Hyperthermostable Pyrocoocus woesei alpha-amylase
PDB Compounds: (A:) alpha amylaseSCOPe Domain Sequences for d1mwoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mwoa1 b.71.1.1 (A:362-434) Bacterial alpha-Amylase {Pyrococcus woesei [TaxId: 2262]}
pglityinlspnwvgrwvyvpkfagaciheytgnlggwvdkrvdssgwvyleapphdpan
gyygysvwsycgv
SCOPe Domain Coordinates for d1mwoa1:
Click to download the PDB-style file with coordinates for d1mwoa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mwoa1:
- d1mwoa1 first appeared in SCOP 1.65
- d1mwoa1 appears in SCOPe 2.07
View in 3D
