Lineage for d1mv5d_ (1mv5 D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1596847Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 1597027Protein Multidrug resistance ABC transporter LmrA, C-terminal domain [102381] (1 species)
  7. 1597028Species Lactococcus lactis [TaxId:1358] [102382] (1 PDB entry)
  8. 1597032Domain d1mv5d_: 1mv5 D: [91472]
    complexed with adp, atp, mg

Details for d1mv5d_

PDB Entry: 1mv5 (more details), 3.1 Å

PDB Description: crystal structure of lmra atp-binding domain
PDB Compounds: (D:) Multidrug resistance ABC transporter ATP-binding and permease protein

SCOPe Domain Sequences for d1mv5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mv5d_ c.37.1.12 (D:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}
mlsarhvdfayddseqilrdisfeaqpnsiiafagpsgggkstifsllerfyqptageit
idgqpidnislenwrsqigfvsqdsaimagtirenltyglegdytdedlwqvldlafars
fvenmpdqlntevgergvkisggqrqrlaiaraflrnpkilmldeatasldsesesmvqk
aldslmkgrttlviahrlstivdadkiyfiekgqitgsgkhnelvathplyakyvseqlt
v

SCOPe Domain Coordinates for d1mv5d_:

Click to download the PDB-style file with coordinates for d1mv5d_.
(The format of our PDB-style files is described here.)

Timeline for d1mv5d_: