Lineage for d1mrub_ (1mru B:)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPKFamily d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
members organized in the groups and subfamiles specified by the comments
Protein Mycobacterial protein kinase PknB, catalytic domain [82793] (1 species)
OPK group; PKN subfamily; serine/threonine kinaseSpecies Mycobacterium tuberculosis [TaxId:1773] [82794] (3 PDB entries) 
Domain d1mrub_: 1mru B: [79426]
complexed with ags, mg
Details for d1mrub_
PDB Entry: 1mru (more details), 3 Å
PDB Description: intracellular ser/thr protein kinase domain of mycobacterium tuberculosis pknb.
PDB Compounds: (B:) Probable serine/threonine-protein kinase pknBSCOPe Domain Sequences for d1mrub_:
Sequence, based on SEQRES records: (download)
>d1mrub_ d.144.1.7 (B:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]}
mttpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrrea
qnaaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraievia
dacqalnfshqngiihrdvkpanimisatnavkvmdfgiaraiadsgnsvtqtaavigta
qylspeqargdsvdarsdvyslgcvlyevltgeppftgdspvsvayqhvredpippsarh
eglsadldavvlkalaknpenryqtaaemradlvrvhngeppeapk
Sequence, based on observed residues (ATOM records): (download)
>d1mrub_ d.144.1.7 (B:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]}
mttpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrrea
qnaaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraievia
dacqalnfshqngiihrdvkpanimisatnavkvmdfgiaraitaqylspeqargdsvda
rsdvyslgcvlyevltgeppftgdspvsvayqhvredpippsarheglsadldavvlkal
aknpenryqtaaemradlvrvhngeppeapk
SCOPe Domain Coordinates for d1mrub_:
Click to download the PDB-style file with coordinates for d1mrub_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mrub_:
- d1mrub_ first appeared in SCOP 1.63
- d1mrub_ appears in SCOPe 2.02
- d1mrub_ appears in SCOPe 2.04
- d1mrub_ appears in the current release, SCOPe 2.08
View in 3D
