| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein ADP-ribosylation factor [52614] (16 species) |
| Species Baker's yeast (Saccharomyces cerevisiae), ARF2 [TaxId:4932] [82401] (1 PDB entry) |
| Domain d1mr3f_: 1mr3 F: [79422] complexed with edo, eoh, g3d, gol, mg, pdo |
PDB Entry: 1mr3 (more details), 1.6 Å
SCOPe Domain Sequences for d1mr3f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mr3f_ c.37.1.8 (F:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARF2 [TaxId: 4932]}
asklfsnlfgnkemrilmvgldgagkttvlyklklgevittiptigfnvetvqyknisft
vwdvggqdrirslwrhyyrntegvifvidsndrsrigearevmqrmlnedelrnavwlvf
ankqdlpeamsaaeiteklglhsirnrpwfiqstcatsgeglyeglewlsnnlknqs
Timeline for d1mr3f_: