Lineage for d1mqea_ (1mqe A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971452Protein ADP-ribose pyrophosphatase [64365] (4 species)
  7. 2971465Species Mycobacterium tuberculosis [TaxId:1773] [103200] (5 PDB entries)
    gene Rv1700
  8. 2971466Domain d1mqea_: 1mqe A: [91394]
    complexed with apr, gd3
    has additional subdomain(s) that are not in the common domain

Details for d1mqea_

PDB Entry: 1mqe (more details), 2 Å

PDB Description: Structure of the MT-ADPRase in complex with gadolidium and ADP-ribose, a Nudix enzyme
PDB Compounds: (A:) ADPR pyrophosphatase

SCOPe Domain Sequences for d1mqea_:

Sequence, based on SEQRES records: (download)

>d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]}
fetissetlhtgaifalrrdqvrmpgggivtrevvehfgavaivamddngnipmvyqyrh
tygrrlwelpaglldvagepphltaarelreevglqastwqvlvdldtapgfsdesvrvy
latglrevgrpeahheeadmtmgwypiaeaarrvlrgeivnsiaiagvlavhavttgfaq
prpldtewidrptafaarraer

Sequence, based on observed residues (ATOM records): (download)

>d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]}
fetissetlhtgaifalrrdqvrivtrevvehfgavaivamddngnipmvyqyrhtygrr
lwelpaglldvagepphltaarelreevglqastwqvlvdldtapgfsdesvrvylatgl
revgrtmgwypiaeaarrvlrgeivnsiaiagvlavhavttgfaqprpldtewidrptaf
aarraer

SCOPe Domain Coordinates for d1mqea_:

Click to download the PDB-style file with coordinates for d1mqea_.
(The format of our PDB-style files is described here.)

Timeline for d1mqea_: