Lineage for d1mpga1 (1mpg A:100-282)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.96: DNA-glycosylase [48149] (1 superfamily)
multihelical; consists of two all-alpha domainsSuperfamily a.96.1: DNA-glycosylase [48150] (7 families) 
Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins) Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [48158] (1 species) Species Escherichia coli [TaxId:562] [48159] (11 PDB entries)
Uniprot P04395
Domain d1mpga1: 1mpg A:100-282 [18747]
Other proteins in same PDB: d1mpga2, d1mpgb2
complexed with gol
Details for d1mpga1
PDB Entry: 1mpg (more details), 1.8 Å
PDB Description: 3-methyladenine dna glycosylase ii from escherichia coli
PDB Compounds: (A:) 3-methyladenine DNA glycosylase IISCOPe Domain Sequences for d1mpga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mpga1 a.96.1.3 (A:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]}
aarpglrlpgcvdafeqgvrailgqlvsvamaakltarvaqlygerlddfpeyicfptpq
rlaaadpqalkalgmplkraealihlanaalegtlpmtipgdveqamktlqtfpgigrwt
anyfalrgwqakdvflpddylikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqp
dea
SCOPe Domain Coordinates for d1mpga1:
Click to download the PDB-style file with coordinates for d1mpga1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mpga1:
- d1mpga1 first appeared (with stable ids) in SCOP 1.55
- d1mpga1 appears in SCOPe 2.07
View in 3D
