Lineage for d1mh5b2 (1mh5 B:114-193)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2026995Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2027314Species Mouse (Mus musculus) [TaxId:10090] [88576] (427 PDB entries)
    Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form
  8. 2027475Domain d1mh5b2: 1mh5 B:114-193 [91269]
    Other proteins in same PDB: d1mh5a1, d1mh5a2, d1mh5b1, d1mh5h1, d1mh5l1, d1mh5l2
    part of the esterolytic Fab ms6-164
    complexed with hal, so4

Details for d1mh5b2

PDB Entry: 1mh5 (more details), 2.1 Å

PDB Description: The Structure Of The Complex Of The Fab Fragment Of The Esterolytic Antibody MS6-164 and A Transition-State Analog
PDB Compounds: (B:) immunoglobulin ms6-164

SCOPe Domain Sequences for d1mh5b2:

Sequence, based on SEQRES records: (download)

>d1mh5b2 b.1.1.2 (B:114-193) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttapsvyplapvcgdtsgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtv

Sequence, based on observed residues (ATOM records): (download)

>d1mh5b2 b.1.1.2 (B:114-193) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttapsvyplapvvtlgclvkgyfpepvtltwvhtfpavlqsdlytlsssvtv

SCOPe Domain Coordinates for d1mh5b2:

Click to download the PDB-style file with coordinates for d1mh5b2.
(The format of our PDB-style files is described here.)

Timeline for d1mh5b2: