SCOP 1.73: Domain d1mh5b2: 1mh5 B:114-193

Lineage for d1mh5b2 (1mh5 B:114-193)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
Domain d1mh5b2: 1mh5 B:114-193 [91269]
Other proteins in same PDB: d1mh5a1, d1mh5a2, d1mh5b1, d1mh5h1, d1mh5l1, d1mh5l2

Details for d1mh5b2

PDB Entry: 1mh5 (more details), 2.1 Å

PDB Description: The Structure Of The Complex Of The Fab Fragment Of The Esterolytic Antibody MS6-164 and A Transition-State Analog

PDB Compounds: (B:) immunoglobulin ms6-164

SCOP Domain Sequences for d1mh5b2:

Sequence, based on SEQRES records: (download)

>d1mh5b2 b.1.1.2 (B:114-193) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttapsvyplapvcgdtsgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtv

Sequence, based on observed residues (ATOM records): (download)

>d1mh5b2 b.1.1.2 (B:114-193) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttapsvyplapvvtlgclvkgyfpepvtltwvhtfpavlqsdlytlsssvtv

SCOP Domain Coordinates for d1mh5b2:

Click to download the PDB-style file with coordinates for d1mh5b2.
(The format of our PDB-style files is described here.)

Timeline for d1mh5b2: