Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88571] (21 PDB entries) Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3) |
Domain d1mfbl2: 1mfb L:112-212 [20984] Other proteins in same PDB: d1mfbh1, d1mfbh2, d1mfbl1 part of Fab SE155-4 |
PDB Entry: 1mfb (more details), 2.1 Å
SCOPe Domain Sequences for d1mfbl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mfbl2 b.1.1.2 (L:112-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]} pksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqs nnkymassyltltarawerhssyscqvtheghtvekslsra
Timeline for d1mfbl2: