Lineage for d1mfal1 (1mfa L:1-111)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757501Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 1757592Species Mouse (Mus musculus) [TaxId:10090] [88541] (35 PDB entries)
  8. 1757593Domain d1mfal1: 1mfa L:1-111 [19888]
    Other proteins in same PDB: d1mfah1
    part of Fv SE155-4

Details for d1mfal1

PDB Entry: 1mfa (more details), 1.7 Å

PDB Description: structure of a single-chain fv fragment complexed with a carbohydrate antigen at 1.7 angstroms resolution
PDB Compounds: (L:) igg1-lambda se155-4 fab (light chain)

SCOPe Domain Sequences for d1mfal1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfal1 b.1.1.1 (L:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qivvtqesalttspgetvtltcrsstgtvtsgnhanwvqekpdhlftgligdtnnrapgv
parfsgsligdkaaltitgaqpedeaiyfcalwsnnhwifgggtkltvlgq

SCOPe Domain Coordinates for d1mfal1:

Click to download the PDB-style file with coordinates for d1mfal1.
(The format of our PDB-style files is described here.)

Timeline for d1mfal1: