Lineage for d1mcww1 (1mcw W:1-111)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
Species Human (Homo sapiens), cluster 4 [TaxId:9606] [88539] (23 PDB entries) 
Domain d1mcww1: 1mcw W:1-111 [20602]
Other proteins in same PDB: d1mcwm2, d1mcww2
part of heterologous L chain dimer MCG-WEIR
Details for d1mcww1
PDB Entry: 1mcw (more details), 3.5 Å
PDB Description: three-dimensional structure of a hybrid light chain dimer. protein engineering of a binding cavity
PDB Compounds: (W:) immunoglobulin weir (light chain)SCOPe Domain Sequences for d1mcww1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mcww1 b.1.1.1 (W:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]}
esaltqpasvsgspgqsitvscaghtsdvadsnsiswfqqhpdkapklliyavtfrpsgi
plrfsgsksgntasltisgllpddeadyfcmsylsdasfvfgsgtkvtvlr
SCOPe Domain Coordinates for d1mcww1:
Click to download the PDB-style file with coordinates for d1mcww1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mcww1:
- d1mcww1 first appeared (with stable ids) in SCOP 1.55
- d1mcww1 appears in SCOPe 2.02
- d1mcww1 appears in SCOPe 2.04
- d1mcww1 appears in the current release, SCOPe 2.08
View in 3D
