Lineage for d1maba2 (1mab A:10-94)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1795771Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1795772Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families) (S)
    automatically mapped to Pfam PF02874
  5. 1795773Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 1795774Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species)
  7. 1795823Species Norway rat (Rattus norvegicus) [TaxId:10116] [88674] (1 PDB entry)
  8. 1795824Domain d1maba2: 1mab A:10-94 [26476]
    Other proteins in same PDB: d1maba1, d1maba3, d1mabb1, d1mabb2, d1mabb3, d1mabg_
    complexed with adp, atp, mg, po4

Details for d1maba2

PDB Entry: 1mab (more details), 2.8 Å

PDB Description: rat liver f1-atpase
PDB Compounds: (A:) protein (f1-ATPase alpha chain)

SCOPe Domain Sequences for d1maba2:

Sequence, based on SEQRES records: (download)

>d1maba2 b.49.1.1 (A:10-94) F1 ATP synthase alpha subunit, domain 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ssileerilgadtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlep
dnvgvvvfgndklikegdivkrtgai

Sequence, based on observed residues (ATOM records): (download)

>d1maba2 b.49.1.1 (A:10-94) F1 ATP synthase alpha subunit, domain 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ssileerigadtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepd
nvgvvvfgndklikegdivkrtgai

SCOPe Domain Coordinates for d1maba2:

Click to download the PDB-style file with coordinates for d1maba2.
(The format of our PDB-style files is described here.)

Timeline for d1maba2: