Lineage for d1m9cc_ (1m9c C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2717818Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2717857Protein HIV-1 capsid protein [47945] (1 species)
  7. 2717858Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)
  8. 2717897Domain d1m9cc_: 1m9c C: [84888]
    Other proteins in same PDB: d1m9ca_, d1m9cb_

Details for d1m9cc_

PDB Entry: 1m9c (more details), 2 Å

PDB Description: X-ray crystal structure of Cyclophilin A/HIV-1 CA N-terminal domain (1-146) M-type Complex.
PDB Compounds: (C:) hiv-1 capsid

SCOPe Domain Sequences for d1m9cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9cc_ a.73.1.1 (C:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmys

SCOPe Domain Coordinates for d1m9cc_:

Click to download the PDB-style file with coordinates for d1m9cc_.
(The format of our PDB-style files is described here.)

Timeline for d1m9cc_: