Lineage for d1m53a2 (1m53 A:43-520)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
members of the family may contain various insert subdomains
in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
Protein Isomaltulose synthase PalI [89466] (2 species) 
Species Klebsiella sp., lx3 [TaxId:576] [89467] (1 PDB entry) 
Domain d1m53a2: 1m53 A:43-520 [84806]
Other proteins in same PDB: d1m53a1
Details for d1m53a2
PDB Entry: 1m53 (more details), 2.2 Å
PDB Description: crystal structure of isomaltulose synthase (pali) from klebsiella sp. lx3
PDB Compounds: (A:) Isomaltulose SynthaseSCOPe Domain Sequences for d1m53a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]}
eypawwkeavfyqiyprsfkdtnddgigdirgiiekldylkslgidaiwinphydspntd
ngydisnyrqimkeygtmedfdslvaemkkrnmrlmidvvinhtsdqhpwfiqsksdknn
pyrdyyfwrdgkdnqppnnypsffggsawqkdaksgqyylhyfarqqpdlnwdnpkvred
lyamlrfwldkgvsgmrfdtvatyskipgfpnltpeqqknfaeqytmgpnihryiqemnr
kvlsrydvatageifgvpldrssqffdrrrhelnmafmfdlirldrdsnerwrhkswsls
qfrqiiskmdvtvgkygwntffldnhdnpravshfgddrpqwreasakalatitltqrat
pfiyqgselgmtnypfrqlnefddievkgfwqdyvqsgkvtatefldnvrltsrdnsrtp
fqwndtlnagftrgkpwfhinpnyveinaereetredsvlnyykkmiqlrhhipalvy
SCOPe Domain Coordinates for d1m53a2:
Click to download the PDB-style file with coordinates for d1m53a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1m53a2:
- d1m53a2 first appeared in SCOP 1.65
- d1m53a2 appears in SCOPe 2.07
View in 3D
