Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Isomaltulose synthase PalI [89385] (1 species) |
Species Klebsiella sp., lx3 [TaxId:576] [89386] (1 PDB entry) |
Domain d1m53a1: 1m53 A:521-598 [84805] Other proteins in same PDB: d1m53a2 |
PDB Entry: 1m53 (more details), 2.2 Å
SCOPe Domain Sequences for d1m53a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m53a1 b.71.1.1 (A:521-598) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} gayqdlnpqdntvyaytrtlgnerylvvvnfkeypvrytlpandaieevvidtqqqaaap hstslslspwqagvyklr
Timeline for d1m53a1: