Lineage for d1m53a1 (1m53 A:521-598)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
folded sheet; greek-keySuperfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) 
this domain is C-terminal to the catalytic beta/alpha barrel domainFamily b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
this domain follows the catalytic beta/alpha barrel domain
Protein Isomaltulose synthase PalI [89385] (1 species) Species Klebsiella sp., lx3 [TaxId:576] [89386] (1 PDB entry) 
Domain d1m53a1: 1m53 A:521-598 [84805]
Other proteins in same PDB: d1m53a2
Details for d1m53a1
PDB Entry: 1m53 (more details), 2.2 Å
PDB Description: crystal structure of isomaltulose synthase (pali) from klebsiella sp. lx3
PDB Compounds: (A:) Isomaltulose SynthaseSCOPe Domain Sequences for d1m53a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m53a1 b.71.1.1 (A:521-598) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]}
gayqdlnpqdntvyaytrtlgnerylvvvnfkeypvrytlpandaieevvidtqqqaaap
hstslslspwqagvyklr
SCOPe Domain Coordinates for d1m53a1:
Click to download the PDB-style file with coordinates for d1m53a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1m53a1:
- d1m53a1 first appeared in SCOP 1.65
- d1m53a1 appears in SCOPe 2.02
- d1m53a1 appears in SCOPe 2.04
- d1m53a1 appears in the current release, SCOPe 2.08
View in 3D
