Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein HslV (ClpQ) protease [56258] (4 species) dodecameric prokaryotic homologue of proteasome |
Species Thermotoga maritima [TaxId:2336] [90045] (1 PDB entry) |
Domain d1m4ya_: 1m4y A: [84802] complexed with na |
PDB Entry: 1m4y (more details), 2.1 Å
SCOPe Domain Sequences for d1m4ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} ttilvvrrngqtvmggdgqvtfgstvlkgnarkvrklgegkvlagfagsvadamtlfdrf eaklrewggnltkaavelakdwrtdrvlrrlealllvadkenifiisgngeviqpdddaa aigsggpyalaaakallrntdlsareivekamtiageiciytnqnivieev
Timeline for d1m4ya_: