Lineage for d1m1xa4 (1m1x A:1-438)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1554689Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1555148Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) (S)
  5. 1555149Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 proteins)
  6. 1555150Protein Integrin alpha N-terminal domain [69320] (2 species)
  7. 1555179Species Human (Homo sapiens), isoform V [TaxId:9606] [69321] (4 PDB entries)
    Uniprot P06756 31-986
  8. 1555180Domain d1m1xa4: 1m1x A:1-438 [74425]
    Other proteins in same PDB: d1m1xa1, d1m1xa2, d1m1xa3, d1m1xb1, d1m1xb2, d1m1xb3, d1m1xb4, d1m1xb5
    complexed with mn, nag

Details for d1m1xa4

PDB Entry: 1m1x (more details), 3.3 Å

PDB Description: crystal structure of the extracellular segment of integrin alpha vbeta3 bound to mn2+
PDB Compounds: (A:) Integrin alpha-V

SCOPe Domain Sequences for d1m1xa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1xa4 b.69.8.1 (A:1-438) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform V [TaxId: 9606]}
fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd
wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq
erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq
gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv
sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf
mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai
aapyggedkkgivyifngrstglnavpsqilegqwaarsmppsfgysmkgatdidkngyp
dlivgafgvdrailyrar

SCOPe Domain Coordinates for d1m1xa4:

Click to download the PDB-style file with coordinates for d1m1xa4.
(The format of our PDB-style files is described here.)

Timeline for d1m1xa4: