Lineage for d1lzwa_ (1lzw A:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.45: ClpS-like [54735] (1 superfamily)
beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/betaSuperfamily d.45.1: ClpS-like [54736] (3 families) 
Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (2 proteins) 
Protein Adaptor protein ClpS (YljA) [82642] (1 species) Species Escherichia coli [TaxId:562] [82643] (8 PDB entries) 
Domain d1lzwa_: 1lzw A: [78312]
Other proteins in same PDB: d1lzwb_
complex with ClpA N-domain
complexed with pt
Details for d1lzwa_
PDB Entry: 1lzw (more details), 2.5 Å
PDB Description: structural basis of clps-mediated switch in clpa substrate recognition
PDB Compounds: (A:) Protein yljASCOPe Domain Sequences for d1lzwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lzwa_ d.45.1.2 (A:) Adaptor protein ClpS (YljA) {Escherichia coli [TaxId: 562]}
ekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavayqgkaicgv
ftaevaetkvamvnkyarenehpllctleka
SCOPe Domain Coordinates for d1lzwa_:
Click to download the PDB-style file with coordinates for d1lzwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lzwa_:
- d1lzwa_ first appeared in SCOP 1.63
- d1lzwa_ appears in SCOPe 2.06
- d1lzwa_ appears in the current release, SCOPe 2.08
View in 3D
