Lineage for d1lsga1 (1lsg A:1-144)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2924219Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2924284Protein Lysozyme [53961] (15 species)
    ubiquitous in a variety of tissues and secretions
  7. 2924292Species Chicken (Gallus gallus) [TaxId:9031] [53962] (908 PDB entries)
    Uniprot P00698
  8. 2925203Domain d1lsga1: 1lsg A:1-144 [36379]
    fused with a fragment of human fibrinogen gamma

Details for d1lsga1

PDB Entry: 1lsg (more details), 2.4 Å

PDB Description: three-dimensional structure of the platelet integrin recognition segment of the fibrinogen gamma chain obtained by carrier protein-driven crystallization
PDB Compounds: (A:) hen egg white lysozyme

SCOPe Domain Sequences for d1lsga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lsga1 d.2.1.2 (A:1-144) Lysozyme {Chicken (Gallus gallus) [TaxId: 9031]}
mkvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqin
srwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtd
vqawirgcrlqqhhlggakqagdv

SCOPe Domain Coordinates for d1lsga1:

Click to download the PDB-style file with coordinates for d1lsga1.
(The format of our PDB-style files is described here.)

Timeline for d1lsga1: