Lineage for d1lqvb_ (1lqv B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2545564Protein Endothelial protein C receptor [75381] (1 species)
    phospholipid-binding protein
  7. 2545565Species Human (Homo sapiens) [TaxId:9606] [75382] (4 PDB entries)
  8. 2545567Domain d1lqvb_: 1lqv B: [74207]
    Other proteins in same PDB: d1lqvc_, d1lqvd_
    complexed with a phospholipid molecule and GLA domain of protein C
    complexed with ca, nag, ndg, pty

Details for d1lqvb_

PDB Entry: 1lqv (more details), 1.6 Å

PDB Description: crystal structure of the endothelial protein c receptor with phospholipid in the groove in complex with gla domain of protein c.
PDB Compounds: (B:) Endothelial protein C receptor

SCOPe Domain Sequences for d1lqvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqvb_ d.19.1.1 (B:) Endothelial protein C receptor {Human (Homo sapiens) [TaxId: 9606]}
lqrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepeswartqs
glqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavngssfvsfr
peralwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhisae

SCOPe Domain Coordinates for d1lqvb_:

Click to download the PDB-style file with coordinates for d1lqvb_.
(The format of our PDB-style files is described here.)

Timeline for d1lqvb_: