Lineage for d1lqsr2 (1lqs R:101-208)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521239Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1521240Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1521550Protein Interleukin-10 receptor 1, IL-10R1 [63670] (1 species)
  7. 1521551Species Human (Homo sapiens) [TaxId:9606] [63671] (5 PDB entries)
  8. 1521557Domain d1lqsr2: 1lqs R:101-208 [74195]
    Other proteins in same PDB: d1lqsl_, d1lqsm_
    complexed with human cytomegalovirus IL-10
    complexed with nag

Details for d1lqsr2

PDB Entry: 1lqs (more details), 2.7 Å

PDB Description: crystal structure of human cytomegalovirus il-10 bound to soluble human il-10r1
PDB Compounds: (R:) interleukin-10 receptor alpha chain

SCOPe Domain Sequences for d1lqsr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqsr2 b.1.2.1 (R:101-208) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]}
evtltvgsvnleihngfilgkiqlprpkmapaqdtyesifshfreyeiairkvpgqftft
hkkvkheqfslltsgevgefcvqvkpsvasrsnkgmwskeecisltrq

SCOPe Domain Coordinates for d1lqsr2:

Click to download the PDB-style file with coordinates for d1lqsr2.
(The format of our PDB-style files is described here.)

Timeline for d1lqsr2:

1521557
d1lqsr2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1lqsr1