![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
![]() | Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (29 PDB entries) |
![]() | Domain d1lp9f1: 1lp9 F:1-117 [91088] Other proteins in same PDB: d1lp9a1, d1lp9a2, d1lp9b_, d1lp9e2, d1lp9f2, d1lp9h1, d1lp9h2, d1lp9i_, d1lp9l2, d1lp9m2 |
PDB Entry: 1lp9 (more details), 2 Å
SCOPe Domain Sequences for d1lp9f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lp9f1 b.1.1.1 (F:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} eaavtqsprskvavtggkvtlschqtnnhdymywyrqdtghglrlihysyvadstekgdi pdgykasrpsqenfslilelaslsqtavyfcassdwvsyeqyfgpgtrltvle
Timeline for d1lp9f1: