Lineage for d1lkna_ (1lkn A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2080272Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2080580Family b.82.1.8: Hypothetical protein TM1112 [89406] (1 protein)
  6. 2080581Protein Hypothetical protein TM1112 [89407] (1 species)
  7. 2080582Species Thermotoga maritima [TaxId:2336] [89408] (3 PDB entries)
  8. 2080586Domain d1lkna_: 1lkn A: [84624]
    structural genomics

Details for d1lkna_

PDB Entry: 1lkn (more details)

PDB Description: solution nmr structure of protein tm_1112 from thermotoga maritima. ontario centre for structural proteomics target tm1112_1_89; northeast structural genomics consortium target vt74.
PDB Compounds: (A:) hypothetical protein tm1112

SCOPe Domain Sequences for d1lkna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lkna_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]}
mevkiekptpeklkelsvekwpiwekevsefdwyydtnetcyilegkvevttedgkkyvi
ekgdlvtfpkglrcrwkvlepvrkhynlf

SCOPe Domain Coordinates for d1lkna_:

Click to download the PDB-style file with coordinates for d1lkna_.
(The format of our PDB-style files is described here.)

Timeline for d1lkna_: