Lineage for d1laue_ (1lau E:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1157714Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1157715Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 1157716Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)
  6. 1157717Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 1157747Species Herpes simplex virus type 1 [TaxId:10298] [52145] (4 PDB entries)
  8. 1157748Domain d1laue_: 1lau E: [31014]
    protein/DNA complex

Details for d1laue_

PDB Entry: 1lau (more details), 1.8 Å

PDB Description: uracil-dna glycosylase
PDB Compounds: (E:) protein (uracil-DNA glycosylase (e.c.3.2.2.-))

SCOPe Domain Sequences for d1laue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1laue_ c.18.1.1 (E:) Uracil-DNA glycosylase {Herpes simplex virus type 1 [TaxId: 10298]}
ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct
pdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle
kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai
rpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv

SCOPe Domain Coordinates for d1laue_:

Click to download the PDB-style file with coordinates for d1laue_.
(The format of our PDB-style files is described here.)

Timeline for d1laue_: