Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) |
Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins) |
Protein Uracil-DNA glycosylase [52143] (5 species) |
Species Herpes simplex virus type 1 [TaxId:10298] [52145] (4 PDB entries) |
Domain d1laue_: 1lau E: [31014] protein/DNA complex |
PDB Entry: 1lau (more details), 1.8 Å
SCOPe Domain Sequences for d1laue_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1laue_ c.18.1.1 (E:) Uracil-DNA glycosylase {Herpes simplex virus type 1 [TaxId: 10298]} ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct pdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai rpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv
Timeline for d1laue_: