Lineage for d1lara2 (1lar A:1628-1876)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1599809Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 1599810Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 1599892Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 1599922Protein RPTP Lar [52815] (1 species)
    duplication: tandem repeat of the phosphatase domain
  7. 1599923Species Human (Homo sapiens) [TaxId:9606] [52816] (1 PDB entry)
  8. 1599925Domain d1lara2: 1lar A:1628-1876 [32694]

Details for d1lara2

PDB Entry: 1lar (more details), 2 Å

PDB Description: crystal structure of the tandem phosphatase domains of rptp lar
PDB Compounds: (A:) protein (lar)

SCOPe Domain Sequences for d1lara2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]}
srfisanlpcnkfknrlvnimpyeltrvclqpirgvegsdyinasfldgyrqqkayiatq
gplaestedfwrmlwehnstiivmltklremgrekchqywpaersaryqyfvvdpmaeyn
mpqyilrefkvtdardgqsrtirqfqftdwpeqgvpktgegfidfigqvhktkeqfgqdg
pitvhcsagvgrtgvfitlsivlermryegvvdmfqtvktlrtqrpamvqtedqyqlcyr
aaleylgsf

SCOPe Domain Coordinates for d1lara2:

Click to download the PDB-style file with coordinates for d1lara2.
(The format of our PDB-style files is described here.)

Timeline for d1lara2:

1599925
d1lara2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1lara1