Lineage for d1la6a_ (1la6 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1976766Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 1976771Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46497] (7 PDB entries)
  8. 1976775Domain d1la6a_: 1la6 A: [73782]
    Other proteins in same PDB: d1la6b_
    complexed with cmo, hem

Details for d1la6a_

PDB Entry: 1la6 (more details), 2 Å

PDB Description: The crystal structure of Trematomus newnesi hemoglobin in a partial hemichrome state
PDB Compounds: (A:) Hemoglobin alpha-1 chain

SCOPe Domain Sequences for d1la6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1la6a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}
slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg
kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

SCOPe Domain Coordinates for d1la6a_:

Click to download the PDB-style file with coordinates for d1la6a_.
(The format of our PDB-style files is described here.)

Timeline for d1la6a_: