Lineage for d1l8qa1 (1l8q A:290-399)
- Root: SCOPe 2.03
Class a: All alpha proteins [46456] (284 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.12: TrpR-like [48295] (3 families) 
contains an extra shared helix after the HTH motif
Family a.4.12.2: Chromosomal replication initiation factor DnaA C-terminal domain IV [81695] (1 protein)
monomeric; contains additional N-terminal helicesProtein Chromosomal replication initiation factor DnaA C-terminal domain IV [81696] (2 species) 
Species Aquifex aeolicus [TaxId:63363] [81697] (2 PDB entries) 
Domain d1l8qa1: 1l8q A:290-399 [77809]
Other proteins in same PDB: d1l8qa2
complexed with adp, mg
Details for d1l8qa1
PDB Entry: 1l8q (more details), 2.7 Å
PDB Description: crystal structure of dna replication initiation factor
PDB Compounds: (A:) Chromosomal replication initiator protein dnaASCOPe Domain Sequences for d1l8qa1:
Sequence, based on SEQRES records: (download)
>d1l8qa1 a.4.12.2 (A:290-399) Chromosomal replication initiation factor DnaA C-terminal domain IV {Aquifex aeolicus [TaxId: 63363]}
gfeglerkerkerdklmqivefvanyyavkvedilsdkrnkrtsearkiamylcrkvcsa
slieiarafkrkdhttvihairsveeekkkdrkfkhlvgflekqafdkic
Sequence, based on observed residues (ATOM records): (download)
>d1l8qa1 a.4.12.2 (A:290-399) Chromosomal replication initiation factor DnaA C-terminal domain IV {Aquifex aeolicus [TaxId: 63363]}
gfeglerkerkerdklmqivefvanyyavkvedilsdkrnkrtsearkiamylcrkvcsa
slieiarafkrkdhttvihairsveeekkrkfkhlvgflekqafdkic
SCOPe Domain Coordinates for d1l8qa1:
Click to download the PDB-style file with coordinates for d1l8qa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l8qa1:
- d1l8qa1 first appeared in SCOP 1.63
- d1l8qa1 appears in SCOPe 2.02
- d1l8qa1 appears in SCOPe 2.04
- d1l8qa1 appears in the current release, SCOPe 2.08
View in 3D
