Lineage for d1l6za2 (1l6z A:108-202)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.4: I set domains [49159] (39 proteins)
  6. Protein Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain [81956] (1 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [81957] (1 PDB entry)
  8. Domain d1l6za2: 1l6z A:108-202 [77771]
    Other proteins in same PDB: d1l6za1, d1l6za3
    complexed with nag

Details for d1l6za2

PDB Entry: 1l6z (more details), 3.32 Å

PDB Description: crystal structure of murine ceacam1a[1,4]: a coronavirus receptor and cell adhesion molecule in the cea family
PDB Compounds: (A:) biliary glycoprotein C

SCOPe Domain Sequences for d1l6za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6za2 b.1.1.4 (A:108-202) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
qpvtqpflqvtnttvkeldsvtltclsndiganiqwlfnsqslqltermtlsqnnsilri
dpikredageyqceisnpvsvrrsnsikldiifdp

SCOPe Domain Coordinates for d1l6za2 are not available.

Timeline for d1l6za2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l6za1, d1l6za3