Lineage for d1l6xa2 (1l6x A:342-443)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1293157Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 1293160Species Human (Homo sapiens) [TaxId:9606] [88590] (33 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 1293161Domain d1l6xa2: 1l6x A:342-443 [73643]
    Other proteins in same PDB: d1l6xa1, d1l6xb_
    part of a Fc

Details for d1l6xa2

PDB Entry: 1l6x (more details), 1.65 Å

PDB Description: fc fragment of rituximab bound to a minimized version of the b-domain from protein a called z34c
PDB Compounds: (A:) immunoglobulin gamma-1 heavy chain constant region

SCOPe Domain Sequences for d1l6xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6xa2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
qprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

SCOPe Domain Coordinates for d1l6xa2:

Click to download the PDB-style file with coordinates for d1l6xa2.
(The format of our PDB-style files is described here.)

Timeline for d1l6xa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l6xa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1l6xb_