Lineage for d1l5za_ (1l5z A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1586637Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1586638Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1586888Protein Transcriptional regulatory protein DctD, receiver domain [52184] (1 species)
  7. 1586889Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [52185] (3 PDB entries)
  8. 1586893Domain d1l5za_: 1l5z A: [77722]
    also includes a part of the linker region
    complexed with gol, so4

Details for d1l5za_

PDB Entry: 1l5z (more details), 2 Å

PDB Description: crystal structure of the e121k substitution of the receiver domain of sinorhizobium meliloti dctd
PDB Compounds: (A:) c4-dicarboxylate transport transcriptional regulatory protein dctd

SCOPe Domain Sequences for d1l5za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l5za_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
saapsvflidddrdlrkamqqtlelagftvssfasatealaglsadfagivisdirmpgm
dglalfrkilaldpdlpmilvtghgdipmavqaiqdgaydfiakpfaadrlvqsarraek
krrlvmenrslrraaeaaseglklaa

SCOPe Domain Coordinates for d1l5za_:

Click to download the PDB-style file with coordinates for d1l5za_.
(The format of our PDB-style files is described here.)

Timeline for d1l5za_: