Lineage for d1l1ja_ (1l1j A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same foldSuperfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) 
Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) 
Protein Protease Do (DegP, HtrA), catalytic domain [74969] (2 species) Species Thermotoga maritima [TaxId:2336] [89339] (1 PDB entry) 
Domain d1l1ja_: 1l1j A: [84516]
catalytic domain only
Details for d1l1ja_
PDB Entry: 1l1j (more details), 2.8 Å
PDB Description: Crystal structure of the protease domain of an ATP-independent heat shock protease HtrA
PDB Compounds: (A:) heat shock protease HtrASCOPe Domain Sequences for d1l1ja_:
Sequence, based on SEQRES records: (download)
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]}
dyespivnvveacapavvkidvvktvktsffdpyfeqffkkwfgelppgferqvaslgsg
fifdpegyiltnyhvvggadnitvtmldgskydaeyiggdeeldiavikikasdkkfpyl
efgdsdkvkigewaiaignplgfqhtvtvgvvsatnrripkpdgsgyyvgliqtdaainp
gnsggpllnihgevigintaivnpqeavnlgfaipintvkkfldtilt
Sequence, based on observed residues (ATOM records): (download)
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]}
dyespivnvveacapavvkidvvkttsffdpyfeqffkkwfgelppgferqvaslgsgfi
fdpegyiltnyhvvggadnitvtmldgskydaeyiggdeeldiavikikasdkkfpylef
gdsdkvkigewaiaignplgfqhtvtvgvvsatnrripkpdgsgyyvgliqtdaainpgn
sggpllnihgevigintaivnpqeavnlgfaipintvkkfldtilt
SCOPe Domain Coordinates for d1l1ja_:
Click to download the PDB-style file with coordinates for d1l1ja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l1ja_:
- d1l1ja_ first appeared in SCOP 1.65
- d1l1ja_ appears in SCOPe 2.07
View in 3D
