Lineage for d1l0li_ (1l0l I:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005102Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3005103Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families) (S)
    not a true superfamily
  5. 3005124Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (2 proteins)
    beta-hairpin and a short alpha-helix bound to the core subunits
  6. 3005125Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species)
  7. 3005126Species Cow (Bos taurus) [TaxId:9913] [90079] (15 PDB entries)
    there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop
    Uniprot P13272 1-57 ! Uniprot P13272
  8. 3005135Domain d1l0li_: 1l0l I: [84495]
    Other proteins in same PDB: d1l0la1, d1l0la2, d1l0lb1, d1l0lb2, d1l0lc1, d1l0lc2, d1l0ld1, d1l0ld2, d1l0le1, d1l0le2, d1l0lf_, d1l0lg_, d1l0lh_, d1l0lj_, d1l0lk_
    complexed with fes, fmx, hem

Details for d1l0li_

PDB Entry: 1l0l (more details), 2.35 Å

PDB Description: structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
PDB Compounds: (I:) ubiquinol-cytochrome c reductase 8 kda protein

SCOPe Domain Sequences for d1l0li_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0li_ d.184.1.3 (I:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]}
mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg

SCOPe Domain Coordinates for d1l0li_:

Click to download the PDB-style file with coordinates for d1l0li_.
(The format of our PDB-style files is described here.)

Timeline for d1l0li_: