| Class b: All beta proteins [48724] (165 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.2: Major surface antigen p30, SAG1 [74877] (1 family) ![]() SS-crosslinked beta-sandwich of distinct geometry but topologically similar to cupredoxins |
| Family b.6.2.1: Major surface antigen p30, SAG1 [74878] (1 protein) |
| Protein Major surface antigen p30, SAG1 [74879] (1 species) duplication: tandem repeat of two homologous domains |
| Species Toxoplasma gondii [TaxId:5811] [74880] (2 PDB entries) |
| Domain d1kzqa1: 1kzq A:3-131 [73374] |
PDB Entry: 1kzq (more details), 1.7 Å
SCOP Domain Sequences for d1kzqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kzqa1 b.6.2.1 (A:3-131) Major surface antigen p30, SAG1 {Toxoplasma gondii [TaxId: 5811]}
plvanqvvtcpdkkstaaviltptenhftlkcpktaltepptlayspnrqicpagttssc
tskavtlsslipeaedswwtgdsasldtagikltvpiekfpvttqtfvvgcikgddaqsc
mvtvtvqar
Timeline for d1kzqa1: