Lineage for d1kyze1 (1kyz E:5-119)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1259531Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (5 proteins)
    unknown function
  6. 1259539Protein Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase [74686] (1 species)
  7. 1259540Species Alfalfa (Medicago sativa) [TaxId:3879] [74687] (2 PDB entries)
  8. 1259543Domain d1kyze1: 1kyz E:5-119 [73316]
    Other proteins in same PDB: d1kyza2, d1kyzc2, d1kyze2
    complexed with fer, sah

Details for d1kyze1

PDB Entry: 1kyz (more details), 2.2 Å

PDB Description: Crystal Structure Analysis of Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase Ferulic Acid Complex
PDB Compounds: (E:) Caffeic acid 3-O-methyltransferase

SCOPe Domain Sequences for d1kyze1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyze1 a.4.5.29 (E:5-119) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}
getqitpthisdeeanlfamqlasasvlpmilksaleldlleiiakagpgaqispieias
qlpttnpdapvmldrmlrllacyiiltcsvrtqqdgkvqrlyglatvakylvkne

SCOPe Domain Coordinates for d1kyze1:

Click to download the PDB-style file with coordinates for d1kyze1.
(The format of our PDB-style files is described here.)

Timeline for d1kyze1: