Lineage for d1kv3a1 (1kv3 A:15-145)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789453Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
  6. 789454Protein Transglutaminase N-terminal domain [49235] (4 species)
    elaborated with many loop insertions in the common fold
  7. 789488Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74844] (2 PDB entries)
    GDP-binding protein
  8. 789490Domain d1kv3a1: 1kv3 A:15-145 [73027]
    Other proteins in same PDB: d1kv3a2, d1kv3a3, d1kv3a4, d1kv3b2, d1kv3b3, d1kv3b4, d1kv3c2, d1kv3c3, d1kv3c4, d1kv3d2, d1kv3d3, d1kv3d4, d1kv3e2, d1kv3e3, d1kv3e4, d1kv3f2, d1kv3f3, d1kv3f4

Details for d1kv3a1

PDB Entry: 1kv3 (more details), 2.8 Å

PDB Description: human tissue transglutaminase in gdp bound form
PDB Compounds: (A:) protein-glutamine gamma-glutamyltransferase

SCOP Domain Sequences for d1kv3a1:

Sequence, based on SEQRES records: (download)

>d1kv3a1 b.1.18.9 (A:15-145) Transglutaminase N-terminal domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
etngrdhhtadlcreklvvrrgqpfwltlhfegrnyqasvdsltfsvvtgpapsqeagtk
arfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsleastgyqgssfvlgh
fillfnawcpa

Sequence, based on observed residues (ATOM records): (download)

>d1kv3a1 b.1.18.9 (A:15-145) Transglutaminase N-terminal domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
etngrdhhtadlcreklvvrrgqpfwltlsltfsvvtgpapsqeagtkarfplrdaveeg
dwtatvvdqqdctlslqlttpanapiglyrlsleasghfillfnawcpa

SCOP Domain Coordinates for d1kv3a1:

Click to download the PDB-style file with coordinates for d1kv3a1.
(The format of our PDB-style files is described here.)

Timeline for d1kv3a1: