Lineage for d1ksra_ (1ksr A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1523789Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1524391Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
    Pfam PF00630
  6. 1524392Protein F-actin cross-linking gelation factor (ABP-120) repeats [49239] (1 species)
  7. 1524393Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [49240] (3 PDB entries)
    Uniprot P13466 547-857
  8. 1524404Domain d1ksra_: 1ksr A: [21897]
    one repeat (Rod 4)

Details for d1ksra_

PDB Entry: 1ksr (more details)

PDB Description: the repeating segments of the f-actin cross-linking gelation factor (abp-120) have an immunoglobulin fold, nmr, 20 structures
PDB Compounds: (A:) gelation factor

SCOPe Domain Sequences for d1ksra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ksra_ b.1.18.10 (A:) F-actin cross-linking gelation factor (ABP-120) repeats {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
adpeksyaegpgldggecfqpskfkihavdpdgvhrtdggdgfvvtiegpapvdpvmvdn
gdgtydvefepkeagdyvinltldgdnvngfpktvtvkpa

SCOPe Domain Coordinates for d1ksra_:

Click to download the PDB-style file with coordinates for d1ksra_.
(The format of our PDB-style files is described here.)

Timeline for d1ksra_: