Lineage for d1ksga_ (1ksg A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein ADP-ribosylation factor [52614] (16 species) 
Species Mouse (Mus musculus), ARL2 [TaxId:10090] [75203] (5 PDB entries) 
Domain d1ksga_: 1ksg A: [72912]
Other proteins in same PDB: d1ksgb_
complexed with GMP-PDE delta
complexed with gtp, mg
Details for d1ksga_
PDB Entry: 1ksg (more details), 2.3 Å
PDB Description: complex of arl2 and pde delta, crystal form 1
PDB Compounds: (A:) arf-like protein 2SCOPe Domain Sequences for d1ksga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ksga_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]}
smglltilkkmkqkerelrllmlgldnagkttilkkfngedvdtisptlgfniktlehrg
fklniwdvggqkslrsywrnyfestdgliwvvdsadrqrmqdcqrelqsllveerlagat
llifankqdlpgalscnaiqealeldsirshhwriqgcsavtgedllpgidwllddissr
SCOPe Domain Coordinates for d1ksga_:
Click to download the PDB-style file with coordinates for d1ksga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ksga_:
- d1ksga_ first appeared in SCOP 1.61
- d1ksga_ appears in SCOPe 2.04
- d1ksga_ is called d1ksga1 in SCOPe 2.06
- d1ksga_ appears in the current release, SCOPe 2.08, called d1ksga1
View in 3D
