Lineage for d1kn1a_ (1kn1 A:)
- Root: SCOPe 2.02
Class a: All alpha proteins [46456] (284 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly openedSuperfamily a.1.1: Globin-like [46458] (5 families) 
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
binds a bilin chromophore
Protein Allophycocyanin alpha subunit [88953] (3 species) 
Species Red algae (Porphyra yezoensis) [TaxId:2788] [88956] (1 PDB entry) 
Domain d1kn1a_: 1kn1 A: [77455]
Other proteins in same PDB: d1kn1b_
complexed with cyc
Details for d1kn1a_
PDB Entry: 1kn1 (more details), 2.2 Å
PDB Description: crystal structure of allophycocyanin
PDB Compounds: (A:) allophycocyaninSCOPe Domain Sequences for d1kn1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kn1a_ a.1.1.3 (A:) Allophycocyanin alpha subunit {Red algae (Porphyra yezoensis) [TaxId: 2788]}
sivtksivnadaearylspgeldriksfvlsgarrvriaqtltenrerivkqagdqlfqk
rpdvvspggnaygeemtatclrdldyylrlvtygivsgdvtpieeiglvgvremykslgt
pisavaegvkcmksvassllsgedsaeagfyfdyvvgamq
SCOPe Domain Coordinates for d1kn1a_:
Click to download the PDB-style file with coordinates for d1kn1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kn1a_:
- d1kn1a_ first appeared in SCOP 1.63
- d1kn1a_ appears in SCOPe 2.01
- d1kn1a_ appears in SCOPe 2.03
- d1kn1a_ appears in the current release, SCOPe 2.08
View in 3D
