Lineage for d1kkoa2 (1kko A:1-160)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649015Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 1649016Protein beta-Methylaspartase [69714] (2 species)
  7. 1649017Species Citrobacter amalonaticus [TaxId:35703] [69716] (2 PDB entries)
  8. 1649018Domain d1kkoa2: 1kko A:1-160 [68676]
    Other proteins in same PDB: d1kkoa1, d1kkob1
    complexed with so4

Details for d1kkoa2

PDB Entry: 1kko (more details), 1.33 Å

PDB Description: crystal structure of citrobacter amalonaticus methylaspartate ammonia lyase
PDB Compounds: (A:) 3-methylaspartate ammonia-lyase

SCOPe Domain Sequences for d1kkoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kkoa2 d.54.1.1 (A:1-160) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]}
mkikqalftagyssfyfddqqaikngaghdgfiytgdpvtpgftsvrqagecvsvqlile
ngavavgdcaavqysgaggrdplflaehfipflndhikpllegrdvdaflpnarffdklr
idgnllhtavryglsqalldatalasgrlktevvcdewql

SCOPe Domain Coordinates for d1kkoa2:

Click to download the PDB-style file with coordinates for d1kkoa2.
(The format of our PDB-style files is described here.)

Timeline for d1kkoa2:

1649018
d1kkoa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1kkoa1