Lineage for d1kkoa1 (1kko A:161-411)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1343755Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1343858Family c.1.11.2: D-glucarate dehydratase-like [51609] (14 proteins)
  6. 1343859Protein beta-Methylaspartase [69400] (2 species)
  7. 1343860Species Citrobacter amalonaticus [TaxId:35703] [69402] (2 PDB entries)
  8. 1343861Domain d1kkoa1: 1kko A:161-411 [68675]
    Other proteins in same PDB: d1kkoa2, d1kkob2
    complexed with so4

Details for d1kkoa1

PDB Entry: 1kko (more details), 1.33 Å

PDB Description: crystal structure of citrobacter amalonaticus methylaspartate ammonia lyase
PDB Compounds: (A:) 3-methylaspartate ammonia-lyase

SCOPe Domain Sequences for d1kkoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kkoa1 c.1.11.2 (A:161-411) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]}
pcvpeaiplfgqsgddryiavdkmilkgvdvlphalinnveeklgfkgeklreyvrwlsd
rilslrsspryhptlhidvygtiglifdmdpvrcaeyiaslekeaqglplyiegpvdagn
kpdqirmltaitkeltrlgsgvkivadewcntyqdivdftdagschmvqiktpdlggihn
ivdavlycnkhgmeayqggtcneteisartcvhvalaarpmrmlikpgmgfdeglnivfn
emnrtiallqt

SCOPe Domain Coordinates for d1kkoa1:

Click to download the PDB-style file with coordinates for d1kkoa1.
(The format of our PDB-style files is described here.)

Timeline for d1kkoa1:

1343861
d1kkoa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1kkoa2