Lineage for d1kida_ (1kid A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850950Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2851157Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) (S)
  5. 2851158Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)
  6. 2851159Protein GroEL, A domain [52031] (4 species)
  7. 2851160Species Escherichia coli [TaxId:562] [52032] (18 PDB entries)
  8. 2851161Domain d1kida_: 1kid A: [30771]
    separately expressed fragment
    mutant

Details for d1kida_

PDB Entry: 1kid (more details), 1.7 Å

PDB Description: groel (hsp60 class) fragment (apical domain) comprising residues 191- 376, mutant with ala 262 replaced with leu and ile 267 replaced with met
PDB Compounds: (A:) groEL (hsp60 class)

SCOPe Domain Sequences for d1kida_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kida_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli [TaxId: 562]}
glvprgsegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavaka
gkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvise
eigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydre
klqervaklaggv

SCOPe Domain Coordinates for d1kida_:

Click to download the PDB-style file with coordinates for d1kida_.
(The format of our PDB-style files is described here.)

Timeline for d1kida_: