Lineage for d1khia2 (1khi A:103-173)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) 
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
barrel, closed; n=5, S=8
Protein C-terminal domain of eIF5a homologue (Hex1) [82105] (2 species) Species Fungus (Neurospora crassa) [TaxId:5141] [82106] (1 PDB entry) 
Domain d1khia2: 1khi A:103-173 [77409]
Other proteins in same PDB: d1khia1
has additional insertions and/or extensions that are not grouped together
Details for d1khia2
PDB Entry: 1khi (more details), 1.78 Å
PDB Description: crystal structure of hex1
PDB Compounds: (A:) Hex1SCOPe Domain Sequences for d1khia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1khia2 b.40.4.5 (A:103-173) C-terminal domain of eIF5a homologue (Hex1) {Fungus (Neurospora crassa) [TaxId: 5141]}
fkqyrvldmqdgsivamtetgdvkqnlpvidqsslwnrlqkafesgrgsvrvlvvsdhgr
emavdmkvvhg
SCOPe Domain Coordinates for d1khia2:
Click to download the PDB-style file with coordinates for d1khia2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1khia2:
- d1khia2 first appeared in SCOP 1.63
- d1khia2 appears in SCOPe 2.07
View in 3D
