Lineage for d1kgce2 (1kgc E:119-247)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein T-cell antigen receptor [49125] (7 species) 
Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (29 PDB entries) 
Domain d1kgce2: 1kgc E:119-247 [77387]
Other proteins in same PDB: d1kgcd1, d1kgce1
LC13 clone
Details for d1kgce2
PDB Entry: 1kgc (more details), 1.5 Å
PDB Description: immune receptor
PDB Compounds: (E:) T-cell receptor beta chainSCOPe Domain Sequences for d1kgce2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kgce2 b.1.1.2 (E:119-247) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad
SCOPe Domain Coordinates for d1kgce2:
Click to download the PDB-style file with coordinates for d1kgce2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kgce2:
- d1kgce2 first appeared in SCOP 1.63
- d1kgce2 appears in SCOPe 2.04
- d1kgce2 appears in SCOPe 2.06
- d1kgce2 appears in the current release, SCOPe 2.08
View in 3D
