Lineage for d1kfus_ (1kfu S:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711466Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)
  6. 2711480Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)
  7. 2711481Species Human (Homo sapiens) [TaxId:9606] [47553] (10 PDB entries)
  8. 2711495Domain d1kfus_: 1kfu S: [68574]
    Other proteins in same PDB: d1kful1, d1kful2, d1kful3

Details for d1kfus_

PDB Entry: 1kfu (more details), 2.5 Å

PDB Description: Crystal Structure of Human m-Calpain Form II
PDB Compounds: (S:) m-calpain small subunit

SCOPe Domain Sequences for d1kfus_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfus_ a.39.1.8 (S:) Calpain small (regulatory) subunit (domain VI) {Human (Homo sapiens) [TaxId: 9606]}
thysnieaneseevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtc
rsmvavmdsdttgklgfeefkylwnnikrwqaiykqfdtdrsgticsselpgafeaagfh
lnehlynmiirrysdesgnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlql
tmys

SCOPe Domain Coordinates for d1kfus_:

Click to download the PDB-style file with coordinates for d1kfus_.
(The format of our PDB-style files is described here.)

Timeline for d1kfus_: