Class b: All beta proteins [48724] (176 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
Domain d1kcwa2: 1kcw A:193-338 [23152] complexed with cu, nag, o |
PDB Entry: 1kcw (more details), 3 Å
SCOPe Domain Sequences for d1kcwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} hidrefvvmfsvvdenfswyledniktycsepekvdkdnedfqesnrmysvngytfgslp glsmcaedrvkwylfgmgnevdvhaaffhgqaltnknyridtinlfpatlfdaymvaqnp gewmlscqnlnhlkaglqaffqvqec
Timeline for d1kcwa2: