SCOPe 2.03: Domain d1kb9e1: 1kb9 E:87-215

Lineage for d1kb9e1 (1kb9 E:87-215)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)

Fold b.33: ISP domain [50021] (1 superfamily)
consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

Superfamily b.33.1: ISP domain [50022] (4 families)
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (3 species)
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63741] (7 PDB entries)

Domain d1kb9e1: 1kb9 E:87-215 [77319]
Other proteins in same PDB: d1kb9a1, d1kb9a2, d1kb9b1, d1kb9b2, d1kb9c1, d1kb9c2, d1kb9d1, d1kb9d2, d1kb9e2, d1kb9f_, d1kb9g_, d1kb9h_, d1kb9i_, d1kb9j_, d1kb9k_
complexed with cdl, fes, hem, pcf, pef, pie, sma, umq, uq6

Details for d1kb9e1

PDB Entry: 1kb9 (more details), 2.3 Å

PDB Description: yeast cytochrome bc1 complex

PDB Compounds: (E:) ubiquinol-cytochrome c reductase iron-sulfur subunit

SCOPe Domain Sequences for d1kb9e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kb9e1 b.33.1.1 (E:87-215) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dvlamakvevnlaaiplgknvvvkwqgkpvfirhrtpheiqeansvdmsalkdpqtdadr
vkdpqwlimlgicthlgcvpigeagdfggwfcpchgshydisgrirkgpaplnleipaye
fdgdkvivg

SCOPe Domain Coordinates for d1kb9e1:

Click to download the PDB-style file with coordinates for d1kb9e1.
(The format of our PDB-style files is described here.)

Timeline for d1kb9e1: