Lineage for d1k8xa_ (1k8x A:)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) 
Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (3 proteins) Protein Trp synthase alpha-subunit [51388] (5 species) Species Salmonella typhimurium [TaxId:90371] [51389] (49 PDB entries) 
Domain d1k8xa_: 1k8x A: [77288]
Other proteins in same PDB: d1k8xb_
complexed with na, plp; mutant
Details for d1k8xa_
PDB Entry: 1k8x (more details), 1.9 Å
PDB Description: crystal structure of alphat183v mutant of tryptophan synthase from salmonella typhimurium
PDB Compounds: (A:) tryptophan synthase, alpha proteinSCOP Domain Sequences for d1k8xa_:
Sequence, based on SEQRES records: (download)
>d1k8xa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
gptiqnanlrafaagvtpaqcfemlaiirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
ieknlaspkqmlaelrsfvsamkaasr
Sequence, based on observed residues (ATOM records): (download)
>d1k8xa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
gptiqnanlrafaagvtpaqcfemlaiirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytylllie
klkeyhaapalqgfgisspeqvsaavragaagaisgsaivkiieknlaspkqmlaelrsf
vsamkaasr
SCOP Domain Coordinates for d1k8xa_:
Click to download the PDB-style file with coordinates for d1k8xa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k8xa_:
- d1k8xa_ first appeared in SCOP 1.63
- d1k8xa_ appears in SCOP 1.73
- d1k8xa_ appears in SCOPe 2.01
- d1k8xa_ appears in the current release, SCOPe 2.08
View in 3D
